LL37 5mg Peptide for Sale – Direct from Shanghai Manufacturer
LL-37 stands as a unique and powerful molecule in the human immune system—the only cathelicidin-derived antimicrobial peptide expressed in humans . This 37-amino acid host defense peptide plays a critical role in innate immunity, directly killing pathogens while modulating immune responses and promoting wound healing . If you are searching for “LL37 peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this host defense peptide and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd. LL37 peptide for sale
We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase LL37 5mg peptide from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. LL37 peptide for sale
Understanding LL-37: The Human Cathelicidin
LL-37 (also known as hCAP18-derived antimicrobial peptide) is a 37-amino acid peptide that is cleaved from the C-terminal end of the human cathelicidin protein, hCAP18 . It is the sole member of the cathelicidin family expressed in humans and plays a multifaceted role in immune defense and cellular regulation . LL37 peptide for sale
Key Characteristics
| Parameter | Specification |
|---|---|
| Sequence | [LL-37, 37 aa] |
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | Approximately 4,493.3 g/mol |
| CAS Number | 154947-66-7 |
| Form | Lyophilized powder |
| Purity | ≥99% (verified by HPLC) |
| Storage | -20°C, protected from light and moisture |
Structural Features
| Feature | Description | Functional Significance |
|---|---|---|
| Amphipathic α-Helix | Forms helical structure in membrane-mimetic environments | Essential for membrane disruption |
| 37 Amino Acids | LL-37 derived from N-terminal LL residues | Full-length bioactive peptide |
| Cationic Nature | Net positive charge (+6 at neutral pH) | Electrostatic attraction to bacterial membranes |
| C-Terminal Amidation | Not amidated (free C-terminus) | Distinct from many antimicrobial peptides |
Why LL-37 Matters in Research
LL-37 has been extensively studied for its dual role as a direct antimicrobial agent and an immunomodulatory peptide . Unlike conventional antibiotics that simply kill bacteria, LL-37 also modulates host immune responses, making it a unique tool for investigating host-pathogen interactions. LL37 peptide for sale
Key Research Applications
| Research Area | Key Findings | Research Context |
|---|---|---|
| Antimicrobial Activity | Kills bacteria, fungi, viruses, and parasites via membrane disruption | Infectious disease, drug resistance |
| Immunomodulation | Chemoattractant for immune cells; modulates cytokine release | Inflammation, autoimmune disease |
| Wound Healing | Promotes angiogenesis and re-epithelialization; reduces biofilm formation | Wound healing models, tissue repair |
| Biofilm Research | Inhibits biofilm formation and disrupts established biofilms | Chronic infections, medical device research |
| Cancer Biology | Induces apoptosis in certain cancer cell lines; modulates immune response | Oncology, tumor immunology |
| Inflammatory Diseases | Dysregulated in psoriasis, rosacea, and inflammatory bowel disease | Dermatology, gastroenterology |
| Host Defense Mechanisms | Functions as alarmin; activates immune cells | Innate immunity, immunology |
Antimicrobial Spectrum
| Microorganism Type | Examples | Activity |
|---|---|---|
| Gram-positive Bacteria | S. aureus, S. pyogenes, B. subtilis | Bactericidal |
| Gram-negative Bacteria | E. coli, P. aeruginosa, S. typhimurium | Bactericidal |
| Fungi | C. albicans, C. neoformans | Fungicidal |
| Viruses | HIV, influenza, RSV | Antiviral |
| Biofilms | P. aeruginosa, S. aureus | Inhibits formation, disrupts existing |
The Critical Importance of Quality for LL-37 Research
When you purchase LL37 peptide for sale, quality parameters are non-negotiable. LL-37 is a 37-amino acid amphipathic peptide that requires precise synthesis to ensure correct folding and full biological activity . LL37 peptide for sale
The Apeptide Quality Standard
-
99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)
-
Mass Spectrometry: Molecular weight confirmation (4,493.3 Da expected)
-
Amino Acid Analysis: Sequence verification of all 37 amino acids
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Counterion Analysis: Acetate or TFA content specified
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: <0.05 EU/mg available for cell culture applications
-
Batch-Specific COAs: Full traceability with Certificates of Analysis
Why Purity Matters for LL-37 Research
-
Antimicrobial Assays: MIC values require precise dosing
-
Cell Culture Applications: Endotoxin levels affect immune cell responses
-
Biofilm Studies: Impurities can confound activity measurements
-
Immunomodulation Studies: Contaminants may activate or suppress immune cells
The Manufacturer Advantage: Why Source LL-37 from Apeptide
When you search for “LL37 peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.
Complete Transparency
-
Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.
-
Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.
-
No Middlemen: You pay manufacturer-direct pricing, not reseller markups. LL37 peptide for sale
Technical Expertise
Our team understands the specific requirements for LL-37 research:
-
Proper handling to prevent aggregation (amphipathic nature)
-
Appropriate reconstitution for antimicrobial assays
-
Storage conditions to maintain activity
-
Documentation requirements for research compliance
Quality You Can Trust
-
Rigorous Testing: Every batch undergoes HPLC and MS analysis
-
Documentation: Full COAs provided for complete traceability
-
Consistency: Reliable quality batch after batch
Seamless Supply to the USA Market
Sourcing LL37 5mg peptide from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.
-
Fast Shipping: 5-7 business days to US addresses
-
Cold-Chain Packaging: Temperature-controlled transit at -20°C for sensitive peptides
-
Desiccant Protection: Double-sealed packaging to prevent moisture absorption
-
Wholesale Programs: Dedicated support for small and large supply companies
-
Customs Expertise: Smooth clearance with complete documentation
-
Tracking Integration: Real-time visibility from Shanghai to your lab
Research Applications: Where LL-37 Excels
Understanding the diverse applications of LL-37 helps researchers appreciate why quality matters. LL37 peptide for sale
Antimicrobial Research
-
Minimum Inhibitory Concentration (MIC) assays
-
Minimum Bactericidal Concentration (MBC) assays
-
Time-kill kinetics studies
-
Membrane permeability assays (SYTOX, propidium iodide)
-
Combination studies with conventional antibiotics
Biofilm Research
-
Biofilm formation inhibition assays (crystal violet)
-
Established biofilm disruption studies
-
Confocal microscopy of biofilm architecture
-
Medical device-associated infection models
Immunology Research
-
Chemotaxis assays (neutrophils, monocytes, T cells)
-
Cytokine/chemokine profiling (ELISA, multiplex)
-
Macrophage polarization studies
-
Dendritic cell activation assays
-
Toll-like receptor (TLR) signaling
Wound Healing Research
-
Scratch wound assays (in vitro)
-
Excisional wound models (in vivo)
-
Angiogenesis assays (HUVEC tube formation)
-
Re-epithelialization studies
Cancer Research
-
Cell viability assays (MTT, CCK-8)
-
Apoptosis detection (Annexin V, caspase-3)
-
Cell migration and invasion assays
-
Tumor microenvironment studies
Frequently Asked Questions
: What exactly is LL37 peptide for sale at Apeptide?
A: LL-37 is a 37-amino acid antimicrobial peptide and the only cathelicidin-derived peptide expressed in humans. It exhibits broad-spectrum antimicrobial activity and immunomodulatory functions. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. LL37 peptide for sale
: What purity levels do you guarantee for LL-37?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation (4,493.3 Da expected), and batch-specific data.
: What is the CAS number for LL-37?
A: The CAS number for LL-37 is 154947-66-7 .
: What is the molecular weight of LL-37?
A: The molecular weight is approximately 4,493.3 g/mol .
: What makes LL-37 unique among antimicrobial peptides?
A: LL-37 is the only cathelicidin-derived antimicrobial peptide expressed in humans. It has dual functions: direct antimicrobial activity via membrane disruption and immunomodulatory effects via chemotaxis and cytokine modulation . LL37 peptide for sale
: What microorganisms does LL-37 target?
A: LL-37 exhibits broad-spectrum activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and parasites. It also inhibits and disrupts biofilms .
: Is your LL-37 for human consumption?
A: Absolutely not. Our LL-37 is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. All products are labeled “FOR RESEARCH USE ONLY.”
: How should I store LL-37 upon receipt?
A: LL-37 should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles. To prevent aggregation, reconstitute immediately before use.
: What solvent should I use for reconstitution?
A: For most research applications, sterile water or PBS (pH 7.4) is appropriate. LL-37 is soluble in aqueous buffers. Note that LL-37 can aggregate in low-ionic-strength solutions. Contact our technical team for application-specific recommendations.
: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.
: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.
: What documentation do you provide for research compliance?
A: Every order includes batch-specific Certificates of Analysis (COAs) with HPLC and MS data. We also provide commercial invoices, packing lists, and customs documentation as needed. LL37 peptide for sale
Quality Control: The Apeptide Standard
Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.
Analytical Methods
-
HPLC Analysis: Every batch tested for purity (typically 99%+)
-
Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation (4,493.3 Da expected)
-
Amino Acid Analysis: Sequence verification of all 37 amino acids
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Counterion Analysis: Acetate or TFA content specified
-
Endotoxin Testing: <0.05 EU/mg available for cell culture applications
-
Stability Studies: Ensuring integrity under various conditions
Batch Documentation
Each shipment includes:
-
Certificate of Analysis with actual test results
-
HPLC chromatogram (available upon request)
-
Mass spectrometry data
-
Batch number for traceability
-
Expiration date and storage recommendations
-
Reconstitution guidelines
Beyond LL-37: A Complete Research Partner
Apeptide (Shanghai) Co., Ltd. is more than just a supplier of LL37 peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.
Our Capabilities
-
Custom Synthesis: Develop proprietary peptides for your specific research needs
-
Catalog Peptides: Hundreds of sequences available for immediate shipment
-
Antimicrobial Peptide Library: Including defensins, cathelicidins, and synthetic analogs
-
Fluorescent Dyes: High-purity labeling agents for imaging and detection
-
Amino Acids: Building blocks for synthesis and research
Quality Certifications & Compliance
-
Licensed manufacturer with physical facility in Pudong District, Shanghai
-
Rigorous quality control protocols
-
Transparent documentation and traceability
-
Experienced technical support team
-
Strict adherence to research-use-only compliance
The Science Behind LL-37: The Human Cathelicidin
LL-37 was first identified in 1995 as the C-terminal peptide of the human cathelicidin protein hCAP18 . The name “LL-37” derives from its N-terminal leucine residues (LL) and its length of 37 amino acids .
The peptide adopts an amphipathic α-helical structure in membrane-mimetic environments, with a hydrophobic face that inserts into bacterial membranes and a hydrophilic face that interacts with the aqueous environment . This structure enables its primary antimicrobial mechanism: membrane disruption .
Beyond direct antimicrobial activity, LL-37 functions as an “alarmin” that alerts the immune system to the presence of pathogens . It acts as a chemoattractant for neutrophils, monocytes, and T cells; modulates cytokine production; and promotes wound healing and angiogenesis . LL37 peptide for sale
LL-37 levels are dysregulated in several human diseases:
-
Psoriasis: Elevated levels correlate with disease severity
-
Rosacea: LL-37 fragments trigger inflammation
-
Inflammatory Bowel Disease: Altered expression in intestinal epithelium
-
Atopic Dermatitis: Reduced levels contribute to increased infections
The multifunctional nature of LL-37 makes it a valuable research tool for studying host defense, inflammation, wound healing, and drug-resistant infections.
The search for premium “LL37 peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need LL-37 for antimicrobial research, immunology studies, wound healing investigations, or specialized host defense research, we are your trusted manufacturing partner. LL37 peptide for sale













Reviews
There are no reviews yet.