Skip to content
  • “High-quality peptides, reliable research.”
    • Email Us
    • Available 24/7!
    • WhatApp Us
  • “High-quality peptides, reliable research.”
Shandong Yixin PeptidesShandong Yixin Peptides
  • Home
  • Shop
  • Bulk Orders
  • Reviews
  • Blog
  • About Us
  • Contact Us
  • Cart / $0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart
Home / Peptides

LL37 5mg

$90.00

Looking for LL37 peptide for sale? Apeptide offers 99% pure research-grade LL-37 (5mg).

Categories: 99% High Purity Peptides, Peptides, Peptides For Sale In USA, Research Peptides Near Me Tags: alastin, alastinskincare serum, antioxidants, bodybuilding, esthetician, ghrp, hcgchica, hcgcommunity hcgresults, hcgdiet, hcgdrop, hcgfamily, hcginjections doral, hcgjourney, hcglife, hcgpellets, hcgphase, hcgplus, hcgprotocol, hcgsupport, hcgusers, hcgweightloss, hcgworks, health, hrt, hyaluronicacid, injectionshcg, lipo, lipotropic, lipotropicinjections, miami, miamibeach, peptideskincare, retinol, sarms, skincareroutine, supplements, testosterone, trihextechnology, vitaminc
  • Description
  • Reviews (0)

LL37 5mg Peptide for Sale – Direct from Shanghai Manufacturer

LL-37 stands as a unique and powerful molecule in the human immune system—the only cathelicidin-derived antimicrobial peptide expressed in humans . This 37-amino acid host defense peptide plays a critical role in innate immunity, directly killing pathogens while modulating immune responses and promoting wound healing . If you are searching for “LL37 peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this host defense peptide and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd. LL37 peptide for sale

We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase LL37 5mg peptide from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. LL37 peptide for sale


Understanding LL-37: The Human Cathelicidin

LL-37 (also known as hCAP18-derived antimicrobial peptide) is a 37-amino acid peptide that is cleaved from the C-terminal end of the human cathelicidin protein, hCAP18 . It is the sole member of the cathelicidin family expressed in humans and plays a multifaceted role in immune defense and cellular regulation . LL37 peptide for sale

Key Characteristics

Parameter Specification
Sequence [LL-37, 37 aa]
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight Approximately 4,493.3 g/mol
CAS Number 154947-66-7
Form Lyophilized powder
Purity ≥99% (verified by HPLC)
Storage -20°C, protected from light and moisture

Structural Features

Feature Description Functional Significance
Amphipathic α-Helix Forms helical structure in membrane-mimetic environments Essential for membrane disruption
37 Amino Acids LL-37 derived from N-terminal LL residues Full-length bioactive peptide
Cationic Nature Net positive charge (+6 at neutral pH) Electrostatic attraction to bacterial membranes
C-Terminal Amidation Not amidated (free C-terminus) Distinct from many antimicrobial peptides

Why LL-37 Matters in Research

LL-37 has been extensively studied for its dual role as a direct antimicrobial agent and an immunomodulatory peptide . Unlike conventional antibiotics that simply kill bacteria, LL-37 also modulates host immune responses, making it a unique tool for investigating host-pathogen interactions. LL37 peptide for sale

Key Research Applications

Research Area Key Findings Research Context
Antimicrobial Activity Kills bacteria, fungi, viruses, and parasites via membrane disruption Infectious disease, drug resistance
Immunomodulation Chemoattractant for immune cells; modulates cytokine release Inflammation, autoimmune disease
Wound Healing Promotes angiogenesis and re-epithelialization; reduces biofilm formation Wound healing models, tissue repair
Biofilm Research Inhibits biofilm formation and disrupts established biofilms Chronic infections, medical device research
Cancer Biology Induces apoptosis in certain cancer cell lines; modulates immune response Oncology, tumor immunology
Inflammatory Diseases Dysregulated in psoriasis, rosacea, and inflammatory bowel disease Dermatology, gastroenterology
Host Defense Mechanisms Functions as alarmin; activates immune cells Innate immunity, immunology

Antimicrobial Spectrum

Microorganism Type Examples Activity
Gram-positive Bacteria S. aureus, S. pyogenes, B. subtilis Bactericidal
Gram-negative Bacteria E. coli, P. aeruginosa, S. typhimurium Bactericidal
Fungi C. albicans, C. neoformans Fungicidal
Viruses HIV, influenza, RSV Antiviral
Biofilms P. aeruginosa, S. aureus Inhibits formation, disrupts existing

The Critical Importance of Quality for LL-37 Research

When you purchase LL37 peptide for sale, quality parameters are non-negotiable. LL-37 is a 37-amino acid amphipathic peptide that requires precise synthesis to ensure correct folding and full biological activity . LL37 peptide for sale

The Apeptide Quality Standard

  • 99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)

  • Mass Spectrometry: Molecular weight confirmation (4,493.3 Da expected)

  • Amino Acid Analysis: Sequence verification of all 37 amino acids

  • Peptide Content Determination: Accurate net peptide weight (≥80% typical)

  • Counterion Analysis: Acetate or TFA content specified

  • Water Content: ≤8.0% by Karl Fischer

  • Endotoxin Testing: <0.05 EU/mg available for cell culture applications

  • Batch-Specific COAs: Full traceability with Certificates of Analysis

Why Purity Matters for LL-37 Research

  • Antimicrobial Assays: MIC values require precise dosing

  • Cell Culture Applications: Endotoxin levels affect immune cell responses

  • Biofilm Studies: Impurities can confound activity measurements

  • Immunomodulation Studies: Contaminants may activate or suppress immune cells


The Manufacturer Advantage: Why Source LL-37 from Apeptide

When you search for “LL37 peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.

Complete Transparency

  • Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.

  • Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.

  • No Middlemen: You pay manufacturer-direct pricing, not reseller markups. LL37 peptide for sale

Technical Expertise

Our team understands the specific requirements for LL-37 research:

  • Proper handling to prevent aggregation (amphipathic nature)

  • Appropriate reconstitution for antimicrobial assays

  • Storage conditions to maintain activity

  • Documentation requirements for research compliance

Quality You Can Trust

  • Rigorous Testing: Every batch undergoes HPLC and MS analysis

  • Documentation: Full COAs provided for complete traceability

  • Consistency: Reliable quality batch after batch


Seamless Supply to the USA Market

Sourcing LL37 5mg peptide from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.

  • Fast Shipping: 5-7 business days to US addresses

  • Cold-Chain Packaging: Temperature-controlled transit at -20°C for sensitive peptides

  • Desiccant Protection: Double-sealed packaging to prevent moisture absorption

  • Wholesale Programs: Dedicated support for small and large supply companies

  • Customs Expertise: Smooth clearance with complete documentation

  • Tracking Integration: Real-time visibility from Shanghai to your lab


Research Applications: Where LL-37 Excels

Understanding the diverse applications of LL-37 helps researchers appreciate why quality matters. LL37 peptide for sale

Antimicrobial Research

  • Minimum Inhibitory Concentration (MIC) assays

  • Minimum Bactericidal Concentration (MBC) assays

  • Time-kill kinetics studies

  • Membrane permeability assays (SYTOX, propidium iodide)

  • Combination studies with conventional antibiotics

Biofilm Research

  • Biofilm formation inhibition assays (crystal violet)

  • Established biofilm disruption studies

  • Confocal microscopy of biofilm architecture

  • Medical device-associated infection models

Immunology Research

  • Chemotaxis assays (neutrophils, monocytes, T cells)

  • Cytokine/chemokine profiling (ELISA, multiplex)

  • Macrophage polarization studies

  • Dendritic cell activation assays

  • Toll-like receptor (TLR) signaling

Wound Healing Research

  • Scratch wound assays (in vitro)

  • Excisional wound models (in vivo)

  • Angiogenesis assays (HUVEC tube formation)

  • Re-epithelialization studies

Cancer Research

  • Cell viability assays (MTT, CCK-8)

  • Apoptosis detection (Annexin V, caspase-3)

  • Cell migration and invasion assays

  • Tumor microenvironment studies


Frequently Asked Questions

: What exactly is LL37 peptide for sale at Apeptide?
A: LL-37 is a 37-amino acid antimicrobial peptide and the only cathelicidin-derived peptide expressed in humans. It exhibits broad-spectrum antimicrobial activity and immunomodulatory functions. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. LL37 peptide for sale

: What purity levels do you guarantee for LL-37?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation (4,493.3 Da expected), and batch-specific data.

: What is the CAS number for LL-37?
A: The CAS number for LL-37 is 154947-66-7 .

: What is the molecular weight of LL-37?
A: The molecular weight is approximately 4,493.3 g/mol .

: What makes LL-37 unique among antimicrobial peptides?
A: LL-37 is the only cathelicidin-derived antimicrobial peptide expressed in humans. It has dual functions: direct antimicrobial activity via membrane disruption and immunomodulatory effects via chemotaxis and cytokine modulation . LL37 peptide for sale

: What microorganisms does LL-37 target?
A: LL-37 exhibits broad-spectrum activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and parasites. It also inhibits and disrupts biofilms .

: Is your LL-37 for human consumption?
A: Absolutely not. Our LL-37 is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. All products are labeled “FOR RESEARCH USE ONLY.”

: How should I store LL-37 upon receipt?
A: LL-37 should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles. To prevent aggregation, reconstitute immediately before use.

: What solvent should I use for reconstitution?
A: For most research applications, sterile water or PBS (pH 7.4) is appropriate. LL-37 is soluble in aqueous buffers. Note that LL-37 can aggregate in low-ionic-strength solutions. Contact our technical team for application-specific recommendations.

: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.

: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.

: What documentation do you provide for research compliance?
A: Every order includes batch-specific Certificates of Analysis (COAs) with HPLC and MS data. We also provide commercial invoices, packing lists, and customs documentation as needed.  LL37 peptide for sale


Quality Control: The Apeptide Standard

Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.

Analytical Methods

  • HPLC Analysis: Every batch tested for purity (typically 99%+)

  • Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation (4,493.3 Da expected)

  • Amino Acid Analysis: Sequence verification of all 37 amino acids

  • Peptide Content Determination: Accurate net peptide weight (≥80% typical)

  • Counterion Analysis: Acetate or TFA content specified

  • Endotoxin Testing: <0.05 EU/mg available for cell culture applications

  • Stability Studies: Ensuring integrity under various conditions

Batch Documentation

Each shipment includes:

  • Certificate of Analysis with actual test results

  • HPLC chromatogram (available upon request)

  • Mass spectrometry data

  • Batch number for traceability

  • Expiration date and storage recommendations

  • Reconstitution guidelines


Beyond LL-37: A Complete Research Partner

Apeptide (Shanghai) Co., Ltd. is more than just a supplier of LL37 peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.

Our Capabilities

  • Custom Synthesis: Develop proprietary peptides for your specific research needs

  • Catalog Peptides: Hundreds of sequences available for immediate shipment

  • Antimicrobial Peptide Library: Including defensins, cathelicidins, and synthetic analogs

  • Fluorescent Dyes: High-purity labeling agents for imaging and detection

  • Amino Acids: Building blocks for synthesis and research

Quality Certifications & Compliance

  • Licensed manufacturer with physical facility in Pudong District, Shanghai

  • Rigorous quality control protocols

  • Transparent documentation and traceability

  • Experienced technical support team

  • Strict adherence to research-use-only compliance


The Science Behind LL-37: The Human Cathelicidin

LL-37 was first identified in 1995 as the C-terminal peptide of the human cathelicidin protein hCAP18 . The name “LL-37” derives from its N-terminal leucine residues (LL) and its length of 37 amino acids .

The peptide adopts an amphipathic α-helical structure in membrane-mimetic environments, with a hydrophobic face that inserts into bacterial membranes and a hydrophilic face that interacts with the aqueous environment . This structure enables its primary antimicrobial mechanism: membrane disruption .

Beyond direct antimicrobial activity, LL-37 functions as an “alarmin” that alerts the immune system to the presence of pathogens . It acts as a chemoattractant for neutrophils, monocytes, and T cells; modulates cytokine production; and promotes wound healing and angiogenesis . LL37 peptide for sale

LL-37 levels are dysregulated in several human diseases:

  • Psoriasis: Elevated levels correlate with disease severity

  • Rosacea: LL-37 fragments trigger inflammation

  • Inflammatory Bowel Disease: Altered expression in intestinal epithelium

  • Atopic Dermatitis: Reduced levels contribute to increased infections

The multifunctional nature of LL-37 makes it a valuable research tool for studying host defense, inflammation, wound healing, and drug-resistant infections.

The search for premium “LL37 peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need LL-37 for antimicrobial research, immunology studies, wound healing investigations, or specialized host defense research, we are your trusted manufacturing partner.  LL37 peptide for sale

Reviews

There are no reviews yet.

Be the first to review “LL37 5mg” Cancel reply

Related products

Sale!
Tesamorelin 5mg

Peptides

Tesamorelin 5mg

$96.00 – $160.00Price range: $96.00 through $160.00
Select options
This product has multiple variants. The options may be chosen on the product page
Sale!
SS-31

Peptides

SS-31

$90.00 – $310.00Price range: $90.00 through $310.00
Select options
This product has multiple variants. The options may be chosen on the product page
BPC 5mg + TB 5mg

Peptides

BPC 5mg + TB 5mg

$95.00
Add to cart
CJC-1295 With DAC

99% High Purity Peptides

CJC-1295 With DAC

$65.00 – $125.00Price range: $65.00 through $125.00
Select options
This product has multiple variants. The options may be chosen on the product page
CJC-1295 Without DAC 5mg + IPA 5mg

99% High Purity Peptides

CJC-1295 Without DAC 5mg + IPA 5mg

$85.00
Add to cart
AOD9604 Peptide

99% High Purity Peptides

AOD9604 Peptide

$50.00 – $170.00Price range: $50.00 through $170.00
Select options
This product has multiple variants. The options may be chosen on the product page
Sale!
Semaglutide

99% High Purity Peptides

Semaglutide

$40.00 – $110.00Price range: $40.00 through $110.00
Select options
This product has multiple variants. The options may be chosen on the product page
HCG 10000IU

Peptides

HCG 10000IU

$70.00 – $125.00Price range: $70.00 through $125.00
Select options
This product has multiple variants. The options may be chosen on the product page

Buy peptides Online USA

At Shandong Yixin Peptides, we specialize in providing premium peptides for sale with 99% purity for research and commercial use. With advanced manufacturing in China and fast distribution across the USA, we are committed to quality, reliability, and customer satisfaction.

UseFul Links
  • Peptides
  • Research Peptides Near Me
  • 99% High Purity Peptides
  • Peptides For Sale In USA
  • Shop
  • Blog
  • Bulk Orders
  • Reviews
  • About Us
Contact Info
All compounds are lab-tested for 99%+ purity and sold strictly for research and laboratory use only. Whether you need small orders or wholesale peptides, we deliver quality you can count on. Shandong Yixin Peptides 📍 No. 9 Lu Shan Road, Dong Cheng Street, Shandong, China 📍 Florida City, FL, USA 📧 Email: support@shandongyixinpeptides.com 📞 Phone: +1 (214) 380-4414 🕒 Hours: Mon – Sat | 9:00 AM – 6:00 PM
Recent Posts
  • USA Peptide Regulations – What Researchers Must Know
  • Peptide Storage Guide – Temperature, Shelf Life, and Handling
  • Semaglutide Research Peptides – What Labs Need to Know
  • Peptide Reconstitution Guide – Step by Step for Beginners
  • BPC-157 Research Applications – What Scientists Are Studying
Copyright 2026 © Shandong Yixin Peptide Co., Ltd! All Rights Reserved!
  • Home
  • Shop
  • Bulk Orders
  • Reviews
  • Blog
  • About Us
  • Contact Us
  • Login

Login

Lost your password?