Retatrutide Peptide for Sale – Direct from Shanghai Manufacturer
Retatrutide represents a paradigm shift in metabolic research—a first-in-class triple agonist that simultaneously activates the GIP, GLP-1, and glucagon receptors . This 39-amino acid peptide, also known as LY3437943, offers researchers an unprecedented tool for investigating the synergistic effects of multiple metabolic pathways on weight regulation, glucose homeostasis, and energy expenditure . If you are searching for “retatrutide peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this innovative triple agonist and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd.
We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase retatrutide peptide for sale from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. retatrutide peptide for sale
Understanding Retatrutide: The First Triple Agonist
Retatrutide (LY3437943) is a synthetic 39-amino acid peptide that functions as a balanced triple agonist of the glucose-dependent insulinotropic polypeptide (GIP), glucagon-like peptide-1 (GLP-1), and glucagon receptors . This triple mechanism represents a significant evolution from dual agonists like tirzepatide, adding glucagon receptor activation to the incretin pathways .
Key Characteristics
| Parameter | Specification |
|---|---|
| Sequence | H-{Aib}-QGTFTSDYSKYLDEKQAAKEFVQWLLDGGPSSGAPPPS-NH₂ |
| Molecular Formula | C₂₂₀H₃₄₄N₄₈O₆₄ |
| Molecular Weight | Approximately 4,946.6 g/mol |
| CAS Number | 2381089-83-2 |
| Form | Lyophilized powder |
| Purity | ≥99% (verified by HPLC) |
| Storage | -20°C, protected from light and moisture |
The Triple Agonist Mechanism
| Receptor Target | Function | Research Implications |
|---|---|---|
| GIP Receptor | Enhances insulin secretion; improves insulin sensitivity; modulates lipid metabolism | GIP pathway studies |
| GLP-1 Receptor | Suppresses appetite; slows gastric emptying; enhances insulin secretion | Incretin pharmacology |
| Glucagon Receptor | Increases energy expenditure; promotes lipid metabolism; enhances hepatic fat oxidation | Energy balance, thermogenesis |
Why Retatrutide Matters in Research
Retatrutide has emerged as a groundbreaking research tool following Phase II clinical trials demonstrating exceptional efficacy—up to 24.2% weight reduction at 48 weeks, the highest ever reported for an obesity intervention . retatrutide peptide for sale
Key Research Findings
| Study | Key Findings | Research Significance |
|---|---|---|
| Phase II Trial (Jastreboff et al., NEJM 2023) | 24.2% weight reduction at 48 weeks (12 mg dose); 48% of participants achieved ≥20% weight loss | Demonstrates unprecedented efficacy of triple agonism |
| Mechanistic Studies | Balanced triple agonism targets complementary pathways: appetite suppression (GLP-1/GIP), energy expenditure (glucagon), and fat metabolism | Provides model for combination therapy research |
| Hepatic Effects | Significant reduction in liver fat content; beneficial in metabolic dysfunction-associated steatohepatitis (MASH) | Hepatic metabolism research |
Potency Comparison
| Compound | Receptor Targets | Weight Reduction (Phase II) |
|---|---|---|
| Retatrutide | GIP + GLP-1 + Glucagon | Up to 24.2% |
| Tirzepatide | GIP + GLP-1 | Up to 22.5% |
| Semaglutide | GLP-1 | Up to 15% |
The Critical Importance of Quality for Retatrutide Research
When you purchase retatrutide peptide for sale, quality parameters are non-negotiable. Retatrutide is a complex 39-amino acid peptide with specific modifications requiring precise synthesis for full biological activity . retatrutide peptide for sale
The Apeptide Quality Standard
-
99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)
-
Mass Spectrometry: Molecular weight confirmation (4,946.6 Da expected)
-
Amino Acid Analysis: Sequence verification of all 39 amino acids
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Aib Residue Confirmation: Verification of non-coded amino acid
-
C-Terminal Amidation Confirmation: Essential for stability
-
Counterion Analysis: Acetate content specified
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: ≤50 EU/mg available for cell culture applications
-
Batch-Specific COAs: Full traceability with Certificates of Analysis
-
Stability Testing: Ensuring integrity from our lab to yours
Why Purity Matters for Retatrutide Research
-
Triple Receptor Studies: EC₅₀ values require precise dosing for three receptor targets
-
In Vivo Studies: Dosing consistency critical for weight and metabolic studies
-
Mechanistic Studies: Pathway analysis requires documented purity
-
Comparative Studies: Reliable quality essential for agonist comparison research
The Manufacturer Advantage: Why Source Retatrutide from Apeptide
When you search for “retatrutide peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice. retatrutide peptide for sale
Complete Transparency
-
Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.
-
Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.
-
No Middlemen: You pay manufacturer-direct pricing, not reseller markups.
Technical Expertise
Our team understands the specific requirements for retatrutide research:
-
Importance of balanced triple agonism for receptor activation
-
Proper handling to maintain peptide stability
-
Appropriate reconstitution for various assay systems
-
Storage conditions to prevent degradation
-
Documentation requirements for research compliance
Quality You Can Trust
-
Rigorous Testing: Every batch undergoes HPLC and MS analysis
-
Documentation: Full COAs provided for complete traceability
-
Consistency: Reliable quality batch after batch
Seamless Supply to the USA Market
Sourcing retatrutide peptide for sale from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners.
-
Fast Shipping: 5-7 business days to US addresses
-
Cold-Chain Packaging: Temperature-controlled transit at -20°C for sensitive peptides
-
Desiccant Protection: Double-sealed packaging to prevent moisture absorption
-
Wholesale Programs: Dedicated support for small and large supply companies
-
Customs Expertise: Smooth clearance with complete documentation
-
Tracking Integration: Real-time visibility from Shanghai to your lab
Research Applications: Where Retatrutide Excels
Understanding the diverse applications of retatrutide helps researchers appreciate why quality matters. retatrutide peptide for sale
Obesity Research
-
Weight regulation and energy homeostasis
-
Diet-induced obesity (DIO) models
-
Appetite suppression mechanisms
-
Body composition studies
-
Adipose tissue biology
Metabolic Research
-
Glucose homeostasis and insulin sensitivity
-
Lipid metabolism and fatty acid oxidation
-
Energy expenditure and metabolic rate
-
Thermogenesis studies
Hepatic Research
-
Non-alcoholic fatty liver disease (NAFLD) models
-
Hepatic steatosis and fibrosis
-
Liver fat content quantification
-
Metabolic dysfunction-associated steatohepatitis (MASH)
Receptor Pharmacology
-
Triple agonist mechanism studies
-
GIP, GLP-1, and glucagon receptor crosstalk
-
Structure-activity relationship investigations
-
Biased agonism and signaling specificity
Comparative Studies
-
Triple agonist vs. dual agonist (tirzepatide)
-
Triple agonist vs. selective GLP-1 (semaglutide)
-
Synergistic pathway analysis
-
Combination therapy models
Frequently Asked Questions
: What exactly is retatrutide peptide for sale at Apeptide?
A: Retatrutide (LY3437943) is a synthetic 39-amino acid peptide that functions as a balanced triple agonist of the GIP, GLP-1, and glucagon receptors. It is the first-in-class triple agonist developed for metabolic research. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. retatrutide peptide for sale
: What purity levels do you guarantee for retatrutide?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation (4,946.6 Da expected), and batch-specific data.
: What is the CAS number for retatrutide?
A: The CAS number for retatrutide is 2381089-83-2 .
: What is the molecular weight of retatrutide?
A: The molecular weight is approximately 4,946.6 g/mol .
: How does retatrutide differ from tirzepatide?
A: Tirzepatide is a dual GIP/GLP-1 receptor agonist. Retatrutide is a triple GIP/GLP-1/glucagon receptor agonist, adding glucagon receptor activation to the dual agonist mechanism. This provides additional effects on energy expenditure and lipid metabolism .
: What makes retatrutide unique among metabolic peptides?
A: Retatrutide is the first triple agonist to demonstrate unprecedented efficacy in clinical trials, with up to 24.2% weight reduction—the highest ever reported for an obesity intervention .
: What is the mechanism of retatrutide’s triple agonism?
A: Retatrutide activates three receptors: GIP and GLP-1 (appetite suppression, insulin secretion) and glucagon (energy expenditure, lipid metabolism). This balanced triple activation produces synergistic metabolic benefits .
: Is your retatrutide for human consumption?
A: Absolutely not. Our retatrutide is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. Retatrutide is an investigational drug in clinical trials and should only be used in approved clinical settings . All products are labeled “FOR RESEARCH USE ONLY.”
: How should I store retatrutide upon receipt?
A: Retatrutide should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles.
: What solvent should I use for reconstitution?
A: For most research applications, sterile water, PBS (pH 7.4), or cell culture medium is appropriate. Retatrutide is soluble in aqueous buffers. Contact our technical team for application-specific recommendations. retatrutide peptide for sale
: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.
: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.
Quality Control: The Apeptide Standard
Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards. retatrutide peptide for sale
-
HPLC Analysis: Every batch tested for purity (typically 99%+)
-
Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation (4,946.6 Da expected)
-
Amino Acid Analysis: Sequence verification of all 39 amino acids
-
Aib Residue Confirmation: Verification of non-coded amino acid
-
C-Terminal Amidation Confirmation: Essential for stability
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Counterion Analysis: Acetate content ≤12.0%
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: ≤50 EU/mg available for cell culture applications
-
Stability Studies: Ensuring integrity under various conditions
Batch Documentation
Each shipment includes:
-
Certificate of Analysis with actual test results
-
HPLC chromatogram (available upon request)
-
Mass spectrometry data
-
Batch number for traceability
-
Expiration date and storage recommendations
-
Reconstitution guidelines
Beyond Retatrutide: A Complete Research Partner
Apeptide (Shanghai) Co., Ltd. is more than just a supplier of retatrutide peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.
Our Capabilities
-
Custom Synthesis: Develop proprietary peptides for your specific research needs
-
Catalog Peptides: Hundreds of sequences available for immediate shipment
-
Triple Agonist Library: Including GLP-1/GIP/glucagon agonists
-
Fluorescent Dyes: High-purity labeling agents for imaging and detection
-
Amino Acids: Building blocks for synthesis and research
Quality Certifications & Compliance
-
Licensed manufacturer with physical facility in Pudong District, Shanghai
-
Rigorous quality control protocols
-
Transparent documentation and traceability
-
Experienced technical support team
-
Strict adherence to research-use-only compliance
The Science Behind Retatrutide: A Breakthrough in Triple Agonism
Retatrutide was developed as a balanced triple agonist of the GIP, GLP-1, and glucagon receptors—a significant evolution from earlier dual agonists . The addition of glucagon receptor activation addresses energy expenditure and lipid metabolism, complementing the appetite suppression effects of GIP and GLP-1 . retatrutide peptide for sale
The molecular design incorporates a non-coded Aib (α-aminoisobutyric acid) residue and C-terminal amidation for enhanced stability and extended half-life . The balanced activation profile is achieved through specific structural modifications that optimize binding affinity across all three receptors .
Preclinical studies demonstrated that retatrutide produces greater weight loss than selective GLP-1 agonists or dual GIP/GLP-1 agonists . Phase II clinical trials confirmed these findings, showing unprecedented weight reduction of up to 24.2% at 48 weeks—the highest ever reported for an obesity intervention . retatrutide peptide for sale
The triple agonist mechanism offers researchers a powerful tool for investigating:
-
The synergistic effects of incretin and glucagon pathways
-
Energy expenditure and thermogenesis mechanisms
-
Hepatic lipid metabolism and fatty liver disease
-
The integrated physiology of appetite and energy balance
The search for premium “retatrutide peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need retatrutide for triple agonist mechanism studies, obesity research, metabolic investigations, or specialized receptor pharmacology, we are your trusted manufacturing partner. retatrutide peptide for sale















Reviews
There are no reviews yet.