Premium Mazdutide 5mg Peptide for Sale – Direct from Shanghai Manufacturer
Mazdutide represents a breakthrough in metabolic research, offering scientists a sophisticated dual agonist approach to studying energy homeostasis and glycemic control. As a novel synthetic peptide that simultaneously activates the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR), mazdutide provides researchers with a powerful tool for investigating the complementary effects of incretin and glucagon pathways on weight regulation, glucose metabolism, and energy expenditure . If you are searching for “mazdutide peptide for sale” for your laboratory investigations, you need a manufacturing partner who understands the complexity of this innovative dual agonist and can deliver the purity your studies demand. That partner is Apeptide (Shanghai) Co., Ltd.
We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase mazdutide peptide for sale from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller. Mazdutide 5mg
Understanding Mazdutide: The Next-Generation Dual Agonist
Mazdutide (also known as IBI362) is a synthetic 39-amino acid peptide that functions as a balanced dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR) . This dual mechanism combines the appetite-suppressing and insulinotropic effects of GLP-1R activation with the energy-expenditure and lipid-metabolizing benefits of GCGR activation .
Key Characteristics
-
Sequence: H-{Aib}-QGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGAPPPS-NH₂ (with C18 di-acid modification)
-
Molecular Formula: C₂₀₀H₃₀₆N₄₄O₆₃
-
Molecular Weight: Approximately 4,500-4,600 g/mol
-
CAS Number: 2259884-03-8
-
Form: Lyophilized powder
-
Purity: ≥99% (verified by HPLC)
-
Storage: -20°C, protected from light and moisture
Mechanism of Action
Mazdutide exerts its effects through balanced dual receptor activation:
| Receptor Target | Function | Research Implications |
|---|---|---|
| GLP-1 Receptor | Suppresses appetite, slows gastric emptying, enhances insulin secretion, promotes beta-cell survival | Studies appetite regulation, glucose homeostasis, and insulin sensitivity |
| Glucagon Receptor (GCGR) | Increases energy expenditure, promotes lipid metabolism, enhances hepatic fat oxidation, stimulates thermogenesis | Investigates metabolic rate, fatty liver mechanisms, and energy balance |
| Synergistic Effect | Balanced dual agonism amplifies weight loss while maintaining glycemic control | Explores combinatorial receptor activation and metabolic pathway integration |
Why Mazdutide Matters in Research
Mazdutide has emerged as a leading research tool in metabolic science, with Phase II clinical trials demonstrating exceptional efficacy in weight reduction and metabolic improvement . The dual mechanism offers advantages over selective GLP-1 agonists by directly targeting energy expenditure alongside appetite suppression. Mazdutide 5mg
Key Research Applications
Scientists seek mazdutide peptide for sale for various laboratory investigations:
| Research Area | Key Findings | Research Context |
|---|---|---|
| Obesity Research | Phase II trials showed up to 15.4% weight reduction at 6 mg dose; significant improvements in waist circumference and cardiometabolic parameters | Metabolic disease models, adipocyte biology |
| Type 2 Diabetes | Clinically meaningful HbA1c reduction; improved fasting and postprandial glucose | Glucose homeostasis, insulin sensitivity studies |
| NASH/NAFLD Research | Significant reduction in liver fat content; improved hepatic steatosis | Fatty liver disease, hepatic metabolism |
| Energy Expenditure | Increases resting energy expenditure via GCGR activation | Metabolic rate, thermogenesis studies |
| Cardiometabolic Health | Improvements in blood pressure, lipid profiles, and inflammatory markers | Cardiovascular risk factors, metabolic syndrome |
| Combination Studies | Investigated with other metabolic agents | Combinatorial therapeutic strategies |
Potent Research-Grade Activity
-
GLP-1R EC₅₀: Sub-nanomolar range (0.1-1.0 nM)
-
GCGR EC₅₀: Sub-nanomolar to low nanomolar range (0.5-5.0 nM)
-
Plasma Half-Life: Approximately 6-7 days, enabling once-weekly dosing studies
-
Albumin Binding: C18 di-acid modification extends half-life via albumin binding
The Critical Importance of Quality for Mazdutide Research
When you purchase mazdutide peptide for sale, quality parameters are non-negotiable. Mazdutide is a complex 39-amino acid peptide with specific modifications (Aib residue, C18 di-acid) that require precise synthesis to ensure correct structure and full biological activity. Mazdutide 5mg
The Apeptide Quality Standard
-
99% Purity Guarantee: Verified by High-Performance Liquid Chromatography (HPLC)
-
Mass Spectrometry: Molecular weight confirmation (4,500-4,600 Da expected)
-
Amino Acid Analysis: Sequence verification of all 39 amino acids
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
C18 Di-Acid Confirmation: Essential for albumin binding and extended half-life
-
Aib Residue Confirmation: Non-coded amino acid verification
-
C-Terminal Amidation Confirmation: Enhances stability and activity
-
Counterion Analysis: Acetate or TFA content specified
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: ≤50 EU/mg available for cell culture applications
-
Batch-Specific COAs: Full traceability with Certificates of Analysis
-
Stability Testing: Ensuring integrity from our lab to yours
Why Purity Matters for Mazdutide Research
-
Dual Receptor Studies: EC₅₀ values in sub-nanomolar range require precise dosing
-
In Vivo Studies: Once-weekly dosing demands consistent, pure material
-
Mechanistic Studies: Pathway analysis requires documented purity
-
Combination Studies: Reliable quality essential for synergistic investigations
The Manufacturer Advantage: Why Source Mazdutide from Apeptide
When you search for “mazdutide peptide for sale,” you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.
Complete Transparency
-
Physical Location: We operate from No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai. You can verify our credentials.
-
Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production.
-
No Middlemen: You pay manufacturer-direct pricing, not reseller markups.
Technical Expertise
Our team understands the specific requirements for mazdutide research:
-
Importance of the C18 di-acid modification for albumin binding
-
Proper handling to maintain peptide stability
-
Appropriate reconstitution for various assay systems
-
Storage conditions to prevent degradation
-
Documentation requirements for research compliance
-
Understanding of dual agonist pharmacology
Quality You Can Trust
-
Rigorous Testing: Every batch undergoes HPLC and MS analysis
-
Documentation: Full COAs provided for complete traceability
-
Consistency: Reliable quality batch after batch
Seamless Supply to the USA Market
Sourcing mazdutide peptide for sale from China should be straightforward. We have optimized our logistics specifically for American researchers and wholesale partners. Mazdutide 5mg
-
Fast Shipping: 5-7 business days to US addresses
-
Cold-Chain Packaging: Temperature-controlled transit at -20°C for sensitive peptides
-
Desiccant Protection: Double-sealed packaging to prevent moisture absorption
-
Wholesale Programs: Dedicated support for small and large supply companies
-
Customs Expertise: Smooth clearance with complete documentation
-
Discreet Packaging: Professional, temperature-controlled containers
-
Tracking Integration: Real-time visibility from Shanghai to your lab
Research Applications: Where Mazdutide Excels
Understanding the diverse applications of mazdutide helps researchers appreciate why quality matters.
Obesity Research
-
Weight regulation and energy homeostasis
-
Adipose tissue browning and thermogenesis
-
Appetite suppression mechanisms
-
Diet-induced obesity (DIO) models
-
Body composition studies
Metabolic Research
-
Glucose homeostasis and insulin sensitivity
-
Lipid metabolism and fatty acid oxidation
-
Energy expenditure and metabolic rate
-
Mitochondrial function studies
Hepatic Research
-
Non-alcoholic fatty liver disease (NAFLD) models
-
Hepatic steatosis and fibrosis
-
Liver fat content quantification
-
Hepatocyte lipid metabolism
Cardiovascular Research
-
Blood pressure regulation
-
Lipid profile improvement
-
Inflammatory marker modulation
-
Metabolic syndrome investigations
Receptor Pharmacology
-
GLP-1R and GCGR dual agonist mechanism
-
Biased agonism and signaling specificity
-
Structure-activity relationship studies
-
Receptor trafficking and desensitization
Frequently Asked Questions
: What exactly is mazdutide peptide for sale at Apeptide?
A: Mazdutide (IBI362) is a synthetic 39-amino acid peptide that functions as a balanced dual agonist of the GLP-1 receptor and glucagon receptor. It combines appetite suppression with increased energy expenditure. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption. Our mazdutide is manufactured at our Shanghai facility with 99% purity verification. Mazdutide 5mg
: What purity levels do you guarantee for mazdutide?
A: We guarantee 99% purity, verified by HPLC testing with Certificates of Analysis available for every batch. Each COA provides detailed purity analysis, mass spectrometry confirmation, and batch-specific data.
: What is the CAS number for mazdutide?
A: The CAS number for mazdutide is 2259884-03-8 .
: What is the molecular weight of mazdutide?
A: The molecular weight is approximately 4,500-4,600 g/mol (exact mass available on COA).
: How does mazdutide differ from semaglutide or tirzepatide?
A: Semaglutide is a selective GLP-1 receptor agonist. Tirzepatide is a dual GIP/GLP-1 receptor agonist. Mazdutide is a dual GLP-1/glucagon receptor agonist, adding energy expenditure and lipid metabolism benefits to appetite suppression . Mazdutide 5mg
: What is the mechanism of mazdutide’s dual agonist activity?
A: Mazdutide activates both the GLP-1 receptor (suppressing appetite, enhancing insulin secretion) and the glucagon receptor (increasing energy expenditure, promoting lipid metabolism). This balanced activation produces synergistic metabolic benefits .
: Is your mazdutide for human consumption?
A: Absolutely not. Our mazdutide is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals. Mazdutide is an investigational drug in clinical trials and should only be used in approved clinical settings . All products are labeled “FOR RESEARCH USE ONLY.”
: How should I store mazdutide upon receipt?
A: Mazdutide should be stored at -20°C (freezer) immediately upon receipt, protected from light and moisture. Lyophilized powder is stable when stored properly. Avoid repeated freeze-thaw cycles.
: What solvent should I use for reconstitution?
A: For most research applications, sterile water, PBS (pH 7.4), or cell culture medium is appropriate. Mazdutide is soluble in aqueous buffers. Contact our technical team for application-specific recommendations. Mazdutide 5mg
: Do you ship to all 50 US states?
A: Yes. We ship to research institutions, laboratories, and wholesale partners throughout the United States.
: Can you accommodate bulk orders for wholesale distribution?
A: Absolutely. We offer competitive wholesale pricing for qualified partners. Contact our team through shanghaiapeptides.com with your volume requirements.
: What documentation do you provide for research compliance?
A: Every order includes batch-specific Certificates of Analysis (COAs) with HPLC and MS data. We also provide commercial invoices, packing lists, and customs documentation as needed. Mazdutide 5mg
Quality Control: The Apeptide Standard
Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.
Analytical Methods
-
HPLC Analysis: Every batch tested for purity (typically 99%+)
-
Mass Spectrometry: ESI-MS or MALDI-TOF for molecular weight confirmation
-
Amino Acid Analysis: Sequence verification of all 39 amino acids
-
Aib Residue Confirmation: Verification of non-coded amino acid
-
C18 Di-Acid Confirmation: Essential for albumin binding
-
C-Terminal Amidation Confirmation: Enhances stability
-
Peptide Content Determination: Accurate net peptide weight (≥80% typical)
-
Counterion Analysis: Acetate content ≤12.0%
-
Water Content: ≤8.0% by Karl Fischer
-
Endotoxin Testing: ≤50 EU/mg available for cell culture applications
-
Stability Studies: Ensuring integrity under various conditions
Batch Documentation
Each shipment includes:
-
Certificate of Analysis with actual test results
-
HPLC chromatogram (available upon request)
-
Mass spectrometry data
-
Batch number for traceability
-
Expiration date and storage recommendations
-
Reconstitution guidelines
Beyond Mazdutide: A Complete Research Partner
Apeptide (Shanghai) Co., Ltd. is more than just a supplier of mazdutide peptide for sale. We are a full-service biochemical manufacturer committed to advancing research worldwide.
Our Capabilities
-
Custom Synthesis: Develop proprietary peptides for your specific research needs
-
Catalog Peptides: Hundreds of sequences available for immediate shipment
-
Dual Agonist Library: Including GLP-1/GCGR, GLP-1/GIP, and other dual agonists
-
Fluorescent Dyes: High-purity labeling agents for imaging and detection
-
Amino Acids: Building blocks for synthesis and research
Quality Certifications and Compliance
-
Licensed manufacturer with physical facility in Pudong District, Shanghai
-
Rigorous quality control protocols
-
Transparent documentation and traceability
-
Experienced technical support team
-
Strict adherence to research-use-only compliance
The Science Behind Mazdutide and Dual Agonism
The concept of dual GLP-1/glucagon receptor agonism represents a sophisticated evolution in metabolic research. While GLP-1 receptor activation provides appetite suppression and insulinotropic effects, adding glucagon receptor activation addresses energy expenditure and lipid metabolism—two key components of metabolic regulation .
Mazdutide’s molecular design incorporates specific modifications that optimize dual receptor activation. The C18 di-acid group binds to albumin, extending the half-life to enable once-weekly dosing studies . The Aib (α-aminoisobutyric acid) residue at position 2 provides resistance to dipeptidyl peptidase-4 (DPP-4) degradation .
Preclinical studies demonstrate that mazdutide achieves greater weight reduction compared to selective GLP-1 agonists by combining reduced caloric intake with increased energy expenditure . This dual mechanism makes mazdutide a valuable tool for investigating the integrated physiology of energy homeostasis.
The search for premium “mazdutide peptide for sale” ends at Apeptide (Shanghai) Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need mazdutide for obesity research, metabolic studies, or specialized dual agonist investigations, we are your trusted manufacturing partner. Mazdutide 5mg












Reviews
There are no reviews yet.